Skip to Content
  • Free Returns and Standard Shipping
  • 0
    My Cart
  • 0
    Wishlist
  • Sign in
  • Home
  • Shop
  • Events
  • Courses
  • Services
  • Pricing
  • Company
    • News
    • Success Stories
    • About Us
  • Jobs
  • Contact us
Mantrabio
  • Contact Us
Mantrabio
  • 0
  • 0
    • Home
    • Shop
    • Events
    • Courses
    • Services
    • Pricing
    • Company
      • News
      • Success Stories
      • About Us
    • Jobs
    • Contact us
  • Free Returns and Standard Shipping
  • Sign in
  • Contact Us
  1. All products
  2. Reagents
  3. ATPαS CAS: 29220-54-0 -5 x 25μl (100 mM)
  4. Reagents
Pricelist: - Pricelist
Pricelist: - Pricelist
ATPαS CAS: 29220-54-0 -5 x 25μl (100 mM)

ATPαS CAS: 29220-54-0 -5 x 25μl (100 mM)

ATP2A2 (SERCA2) Polyclonal Antibody - 100 uL
211.00 € 211.00 €

Add to cart
Add to wishlist
Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days
Contact Us

Uniprot No.: P16615


Target Name: ATP2A2


Alternative Names: AT2A2_HUMAN antibody; Atp2a2 antibody; ATP2B antibody; ATPase Ca++ transporting cardiac muscle slow twitch 2 antibody; Calcium pump 2 antibody; Calcium-transporting ATPase sarcoplasmic reticulum type antibody; Calcium-transporting ATPase sarcoplasmic reticulum type slow twitch skeletal muscle isoform antibody; Cardiac Ca2+ ATPase antibody; DAR antibody; DD antibody; Endoplasmic reticulum class 1/2 Ca(2+) ATPase antibody; MGC45367 antibody;  Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 antibody; SERCA 2 antibody; SERCA2 antibody; serca2a antibody; slow twitch skeletal muscle isoform antibody


Raised in: Rabbit


Species Reactivity: Human, Mouse, Rat


Immunogen: Synthesized peptide derived from the C-terminal region of Human SERCA2 (841-890aa).


Immunogen sequence: CYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFEGVDCAIF


Immunogen Species: Homo sapiens (Human)


Conjugate: Non-conjugated


Isotype: IgG


Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen.


Concentration: usually 1mg/ml (Batch dependent)


Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.


Form: Liquid


Tested Applications: WB, ELISA

WB: 1:500-1:2000

ELISA: 1:20000


Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze.


PDF datasheet: 

Products

  • Baby Care
  • Beauty
  • First Aid
  • Health Devices
  • Medications
  • Personal Care

All Products

Customer Care

  • Help Center
  • Returns
  • Delivery
  • Shipping
  • Contact us
Our payment methods


Low Prices Easy Returns Fast Shipping

Follow us
© Company name - Terms & Conditions - Privacy Policy
Powered by Odoo - The #1 Open Source eCommerce